SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025033 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025033
Domain Number 1 Region: 1343-1570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.2e-39
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 389-501
Classification Level Classification E-value
Superfamily Cadherin-like 5e-31
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 805-917
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 4 Region: 1593-1786
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-28
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 5 Region: 494-599
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 174-277
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 696-803
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 8 Region: 279-387
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 905-1018
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 599-700
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 1012-1114
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000143
Family Cadherin 0.0077
Further Details:      
 
Domain Number 12 Region: 1270-1360,1557-1606
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1919-1959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1825-1871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000252
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 1790-1824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025033   Gene: ENSBTAG00000018804   Transcript: ENSBTAT00000025033
Sequence length 2918
Comment pep:known chromosome:UMD3.1:3:34246411:34270498:-1 gene:ENSBTAG00000018804 transcript:ENSBTAT00000025033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPAARAPLPTPLPPLLLLLLLPPLLGDQVGPCRSLGPGGRGSSGACAPVGWLCPASSSN
LWLYTSRCRDAGTELTGHLVPHHDGLRVWCPESGAHIPLPPAPEGCPWSCRLLGIGGHLS
PQGKLTLPHEHLCLKAPRLRCQSCKLVQAPGFRAGDSLAEESMGGRRKRNVNTAPQFQPP
SYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPITGAVTTA
EELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRENLEV
GYEVLTVRATDGDAPPNANILYRLLEESGGSPSEVFEIDPRSGVIRTRGPVDREEVESYQ
LTVEASDQGRDPGPRTATAAIFLSVEDDNDNAPQFSEKRYVVQVREDVAPGAPVLRVTAS
DRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGGRPPL
SNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARLEYRL
AGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTILDVN
DNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITSQSGG
GLVSLALPLDYKLERQYVLAVTASDGTRQDTAQVVVNVTDANTHRPVFQSSHYTVNINED
RPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVSYTLA
ITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISATDRDS
GLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPPARTP
MDVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQIVEGN
IPEVFQLDIFSGELTALVDLDYDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNPPVLGN
FEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTGELRLS
RALDNNRPLEAVMSVLVSDGVHSVTAQCSLRVTIITDEMLTHSITLRLEDMSPERFLSPL
LGLFIQAVAATLATPPDHVVIFNVQRDTDAPGSHILNVSLSVGQPPGPGGGPPFLPSEDL
QERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSSVLFRP
IHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGHCRSREGGYTCLCRDGYTGEHCEV
SARSGRCTPGVCKNGGTCVNLLVGGFKCNCPSGDFEKPFCQVTTRSFPARSFITFRGLRQ
RFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVSPFVPG
GVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGAMLGNYSCA
AQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRTRQFVGCIRNLQVDSRHVDMADFIANN
GTMPGCPAKKNVCDSNSCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQRFLGSSLL
AWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLREGRVVLSVEGTGLQAS
SLQLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLHGLHLSNVTVG
GVPGPASGVARGFRGCLQGVRVSETPEGVSSLDPSRGESINVEPGCSLPDPCDSNPCPAN
SYCSDDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSMCTRKPSAPHGYTCECPPSYLGPY
CETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPACLLCD
CYPTGSLSRVCDPEEGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAIEAGIW
WPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERLQRNES
GLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQDVHFT
ENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTP
NIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFRETPPVVRPAGPGEPQ
EPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVINTPVVSI
SVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCEVVFRN
ESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFLFLAVLRTLR
SNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLFLCAFAWALLEALHLY
RALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLIWSFTG
PVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLRPSFAVLLLLSATWLLALLSVNS
DTLLFHYLFAASNCVQGPFIFLSYVVLSKEVRKALKFACSRRPSPDPALTTKSTLTSSYN
CPSPYGDGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQGPPGLGDPGGL
FLEGQNQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEVEREAAFPGEPGWDSLL
GPGAERLPLHSTPKDGGLGPGKVPWPGDFGTTAKEGGGNGASEERPRENGDALTWEGSLG
PLPGPSAQPHKGILKKKCLPTISEKSSLLRLPPEQGTTSSRGSSASEGSRAGPPPRPPPR
QSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences E1BJ11
ENSBTAP00000025033 ENSBTAP00000025033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]