SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025038 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025038
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.61e-58
Family Ran-binding protein mog1p 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025038   Gene: ENSBTAG00000018809   Transcript: ENSBTAT00000025038
Sequence length 186
Comment pep:known_by_projection chromosome:UMD3.1:19:28519719:28521133:1 gene:ENSBTAG00000018809 transcript:ENSBTAT00000025038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDYPLFGGAFSATLPPGAIDVSDLRPVPDHQEVFCHRVTDQSLIVELLELQAHVQG
EEAARYHFEDVGGVQEARAVQVETVQPLVLENLALRGCCQEAWILSGQQQVAKENQQVAK
YVTLHQALLRLPQYQTDLLLTFNQPPPENRSSLGPENLSIPPWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences F1MW14 L8INC2
ENSBTAP00000025038 9913.ENSBTAP00000025038 XP_005894886.1.15283 XP_010841341.1.44457 XP_019837863.1.53367 ENSBTAP00000025038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]