SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025122 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025122
Domain Number 1 Region: 365-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.17e-77
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 196-309
Classification Level Classification E-value
Superfamily Kringle-like 1.47e-23
Family Kringle modules 0.0012
Further Details:      
 
Domain Number 3 Region: 35-89
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-19
Family Fibronectin type II module 0.0052
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000252
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025122   Gene: ENSBTAG00000018872   Transcript: ENSBTAT00000025122
Sequence length 612
Comment pep:known_by_projection chromosome:UMD3.1:7:40258129:40266423:-1 gene:ENSBTAG00000018872 transcript:ENSBTAT00000025122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGALLVSLESTVSTPPWKGPKKHKLTESEHTVVLTVTGEPCHFPFQYHRQLHHK
CTHRGRPGPRPWCATTPNFEKDQRWAYCLEPKKVKDHCSKHNPCQKGGTCVNMPDGPRCI
CADHFTGKHCQKEKCFEPQFFRFFHENEIWHRLEPAGVVKCQCKGPNAQCKPLASQVCRT
NPCLNGGSCLQAEGHRLCRCAPSFAGRLCDVDLKASCYDDRDRGLSYRGMAGTTLSGAPC
QSWASEATYWNVTAEQVLNWGLGDHAFCRASTPPRGYRNPDNDTRPWCFIWKGDRLSWNY
CRLAPCQAAAGHEHFPLPSPSALQKPESTTQTPLPSLTSGWCSPTPLASGGPGGCGQRLR
KWLSSLNRVVGGLVALPGAHPYIAALYWDQHFCAGSLIAPCWVLTAAHCLQNRPAPKELT
VVLGQDRHNQSCEQCQTLAVRDYRLHEAFSPITYQHDLALVRLQESADGCCAHPSPFVQP
VCLPSTAARPAESEAAVCEVAGWGHQFEGGEYSSFLQEAQVPLIDPQRCSAPDVHGAAFT
QGMLCAGFLEGGTDACQGDSGGPLVCEDETPERQLILRGIVSWGSGCGNRLKPGVYTDVA
NYLAWIREHTAS
Download sequence
Identical sequences F1MTT3
9913.ENSBTAP00000025122 9913.ENSBTAP00000045210 ENSBTAP00000025122 ENSBTAP00000025122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]