SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025161 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025161
Domain Number 1 Region: 622-1149
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.85e-153
Family alpha-mannosidase, C-terminal domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 124-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.21e-141
Family alpha-mannosidase 0.000000000831
Further Details:      
 
Domain Number 3 Region: 502-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 5.23e-29
Family alpha-mannosidase, domain 2 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025161   Gene: ENSBTAG00000018905   Transcript: ENSBTAT00000025161
Sequence length 1150
Comment pep:known_by_projection chromosome:UMD3.1:21:22166073:22183354:-1 gene:ENSBTAG00000018905 transcript:ENSBTAT00000025161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANVEGPPALLPYYVANGSWVVPPEPRPSFFSISPQDCQFAL
GGRGPKPELQMLTISEELPFDNVDGGVWKQGFDISYSPHDWDSEDLQVFVVPHSHNDPGW
LKTFDKYYTEQTQHILNNMVSKLQEDPRRRFIWAEVSFFAKWWDNISAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLEKNLGATPRSGWAVDPFGYSPTMPYL
LRRANLTSMLIQRVHYAIKKHFAASHSLEFMWRQTWDSDASTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRISCPWKVPPRAITEANVAERAGLLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPDLHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKNLDRVLEAHLRGAEILYSLAVAHAR
RAGLASQFPLSNFALLTDARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVIM
NAAHYLVLGDKKTYHFDPEVPFLQMDDTRLNHDALPERTVIQLESSPRYVVLFNPLEQER
LSVVSLLVSSPRVRVLSEEGQPLAVQVSAHWSSATDMVPDVYQVSVPVRLPALGLGVLQL
QQGLDGPRTLPSSVRVYLHGRPLSVSRNEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGL
LKSVRRVDEEQEQRVDMEFLVYGTRSSKDKSGAYLFLPDGEAKPYVPRDPPVLRVTEGPF
FSEVVACYEHVHQVVRLYNLPGVEGLSLDVSSLVDIRDYVNKELALRIRTDINSQGIFFT
DLNGFQVQPRRYLKKLPLQANFYPMPVMAYLQDAQNRLTLHTAQALGVSSLHDGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTCNHFRLLLERRTPGREVREAASASFPSLLSHLTSMYLN
TPVLALPVARRQAPGPALRSFHPLASSLPCDFHLLNLRTLQAEEDGLPSAETALLLHRKG
FDCGLEAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYVEPM
EITTFRLRLG
Download sequence
Identical sequences E1BGJ4
9913.ENSBTAP00000025161 NP_001179570.1.59421 NP_001179570.1.76553 XP_010839361.1.44457 XP_010839362.1.44457 XP_010839363.1.44457 XP_015314673.1.76553 XP_015314674.1.76553 XP_015314675.1.76553 ENSBTAP00000025161 ENSBTAP00000025161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]