SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025189 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025189
Domain Number 1 Region: 53-189
Classification Level Classification E-value
Superfamily L domain-like 1.41e-34
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025189   Gene: ENSBTAG00000017814   Transcript: ENSBTAT00000025189
Sequence length 538
Comment pep:known chromosome:UMD3.1:18:46040472:46049240:-1 gene:ENSBTAG00000017814 transcript:ENSBTAT00000025189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAGILLLLLLAGLGVGEAWRPPKGKCPLSCSCSKDSALCEGSVDLPEILSPTLLSLSF
VRTRITQLKAGSFLRVPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNA
LRGLRSLTHLSLANNHLETLPRFLFRGLETLTHVDLRGNPFQCDCRVLWLLQWIPTVNAS
VGTGACAGPAALAHMQLRHVDPKTFKCRAIELSWFQTVGESALGVEAFSYQEEPYIVLAQ
PFAGRCLILAWDYSLQRFRQEEELSAPSVVSCKPLVLGPRLFMLAARLWGGSQLWARPGP
DLRLAPLQALAPRRLLRPNDAELLWLDGQPCFVVADASKAGSTTLLCRDGPGFYPRQSLH
AWHRDTDVEALELDGRPHLLLASASQRPVLFHWFGGRFERRTDIPEAEDVYATRHFQAGG
DVFLCLTRYIGDSMVMRWDGSMFRLLQKLPSRGAHVFQPLLIAKDQLAILGSDFAFSQVF
RLEPDKGLLEPLQELGPPAIVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHELDLSA
Download sequence
Identical sequences A6QLD0
ENSBTAP00000025189 NP_001096771.1.59421 NP_001096771.1.76553 ENSBTAP00000025189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]