SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025190 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025190
Domain Number 1 Region: 432-588
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-26
Family SPRY domain 0.0088
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-17
Family RING finger domain, C3HC4 0.031
Further Details:      
 
Domain Number 3 Region: 182-244
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025190   Gene: ENSBTAG00000018920   Transcript: ENSBTAT00000025190
Sequence length 649
Comment pep:known_by_projection chromosome:UMD3.1:19:56373299:56377735:1 gene:ENSBTAG00000018920 transcript:ENSBTAT00000025190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGTLWPHRGAGGAGGPGGTARCPLSQEP
FPDGLQLRKNHKQSELLQLRQGSGPGPGPCPAPAPSPCPAPAPGPAPAPEPATPSAPPSA
PEPSAPCAPESWPPGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGH
RLVPPLRRLEESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQ
PKVLSAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFAEAAAVLQGFQTQVLGF
IDEGEATMLGRSQGDLRRQEEQRSRLSRARHNLSQVPEADSVSFLQELLALRLALEEGCG
PGPGPPKELSFTKSSQAVRAVRAVLAAACSSQWEQLRGLGGDEDGLQKPGTEADAESQDP
DSTNNLESEAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHC
EQVLGEGALDRGTYYWEVEIIEGWVSVGVMAEDFSPQEPYDRGRLGRNAYSCCLQWNGRS
FSVWFHGQEAPLPHPFSPTVGICLEYADRALAFYAVRDGKMSLLRRLRASRRRSGTPASP
VDPFQSRLDSHFAGLFTRRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences E1BG23
ENSBTAP00000025190 ENSBTAP00000025190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]