SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025207 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025207
Domain Number 1 Region: 319-648
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.92e-70
Family Pancreatic carboxypeptidases 0.00000198
Further Details:      
 
Domain Number 2 Region: 141-301
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 648-737
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.16e-20
Family Carboxypeptidase regulatory domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025207   Gene: ENSBTAG00000018941   Transcript: ENSBTAT00000025207
Sequence length 761
Comment pep:known chromosome:UMD3.1:26:43829293:43966907:-1 gene:ENSBTAG00000018941 transcript:ENSBTAT00000025207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPPGVTVPQPVRQLERPFGWTLLGISGEAGSQHRPASEGGETWSLEPSYARREPEPEPF
SPPLPAGPGAGERGPRPPQPRPPKKATTKPKKAPKREKLAPQTPRPGKNINRKGMRTKSS
EKAASDDHGVPLARDAVREGCPPLGLETLKITDFQLHASTSKRYGLGAHRGRLNIQAGIN
ENDFYDGAWCAGRNDLHQWIEVDARRLTKFTGVITQGRNSLWLSDWVTSYKVMVSNDSHT
WVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWFDNGSICMRMEILGCPL
PDPNNYYHRRNEMTTTDDLDFKHHNHKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYA
VEISDHPGEHEVGEPEFHYIAGAHGNEVLGRELMLLLMQFLCQEYLAGNLRIVRLVEETR
IHILPSLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNIPRK
VPNHYIAIPEWFLSENATVAVETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDMVRSLWK
TQEHTPTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEDGTVNGASWHTVAGSLN
DFSYLHTNCFELSIYVGCDKYPHESELPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKG
IPNAVISVEGVNHDIRTASDGDYWRLLNPGEYVVTAKAEGFTSSTKNCMVGYDMGATQCD
FTLSKTNLARIREIMEKFRKQPVSLPARRLKLQGRKRRQRG
Download sequence
Identical sequences E1BER3
ENSBTAP00000025207 ENSBTAP00000025207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]