SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025217 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025217
Domain Number 1 Region: 241-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.88e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000778
Further Details:      
 
Domain Number 2 Region: 93-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000707
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 
Domain Number 3 Region: 14-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000576
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025217   Gene: ENSBTAG00000018948   Transcript: ENSBTAT00000025217
Sequence length 669
Comment pep:known chromosome:UMD3.1:18:53991370:54022923:1 gene:ENSBTAG00000018948 transcript:ENSBTAT00000025217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCTAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHNIFDFIHPCDQEELQDALTPRQSLSKKKPEAPTERCFSLRMKSTLSSRGRTLN
LKAATWKVLHCSGHMRVYKPPAQTSPAGSPNLEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVGQSIHTLLSKGQAV
TGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETEVVLSLEQTERHS
RRHVQRGSPSQKDAPNPGDRLDTSGPRILAFLHPPALSEAALAADPRRFCSPDLRRLLAP
ILDGTSVAATPSAPPATRRPQSPLPADLPDDLLVDVENAHKVLASGKDLQTVETDLDIAQ
DVDALDLEMLAPYISMDDDFQLNSSEQLPRAYHRPPGAVPRPRARSFHGMSPPTPETSLL
PRWGSDPRLSCSSPSRGDPSASSPMVGARKRALIPSSEDEAEKVELLGIRPPKRSPSLEP
ENFLLPPLSLSFLLTGGPAPGSRQDPSTHLVELNEPLGPGPSLLSLYPDEDTAQPRSHFQ
LAAGLAQAN
Download sequence
Identical sequences A7Z028
NP_001098812.1.59421 NP_001098812.1.76553 XP_019834993.1.53367 ENSBTAP00000025217 9913.ENSBTAP00000025217 ENSBTAP00000025217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]