SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025307 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025307
Domain Number 1 Region: 523-849
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.41e-75
Family Hect, E3 ligase catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 172-370
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-41
Family APC10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025307   Gene: ENSBTAG00000019013   Transcript: ENSBTAT00000025307
Sequence length 861
Comment pep:known chromosome:UMD3.1:3:101623083:101631050:1 gene:ENSBTAG00000019013 transcript:ENSBTAT00000025307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPGPGAALESPRQLLGRVRFLAEAAKSLRAGRPLPAALAFVPREVLYKLYKDPAGPSR
VLLPVWEAEGLGLRVGATGPAPGTGSGALRAARDSIELRRGACVRTTGEELCNGHGLWVK
LTKEQLAEHLGDCGLDEGWLLVCRPAEGGARLVPIDTPDHLQRQQQLFGVDYRPVLRWEQ
VVDLTYSHRLGSRPQPAEAYTEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSV
KQYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDT
TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDG
IDVRLRGVKIKSSRQRELGLNADLFQPTNLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
VLHHLVPAWDHTLGTFSEIKQVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRL
AMEHRACPLRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQ
GGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEW
IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF
EFKFGKELTFTTVLSDQQVVELIPGGSGIVVGYEDRSRFIQLVQKARLEESKEQVAAMQA
GLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDTRVQYFWEALNNF
TNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
KLRYAAYNCVAIDTDMSPWEE
Download sequence
Identical sequences F1MJS5 L8IPJ1
9913.ENSBTAP00000025307 ENSBTAP00000025307 ENSBTAP00000025307 XP_005894252.1.15283 XP_011987144.1.54773 XP_017898995.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]