SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025458 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025458
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily DEATH domain 2e-23
Family Pyrin domain, PYD 0.0041
Further Details:      
 
Domain Number 2 Region: 621-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-18
Family SPRY domain 0.00041
Further Details:      
 
Domain Number 3 Region: 392-457
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.34e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025458   Gene: ENSBTAG00000019123   Transcript: ENSBTAT00000025458
Sequence length 771
Comment pep:known_by_projection chromosome:UMD3.1:25:2691854:2704324:-1 gene:ENSBTAG00000019123 transcript:ENSBTAT00000025458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRTRSDHLLYSLEELLPYDFEKFKFKLQNTSLEKEHLRIPRGQLQTAEPVKLASLMVNH
YGEEYAVQLTLQVLRAINQHLLAEELHQVISPECRIQESDTDSSAMSGSSGEMKPKSLKT
PDGLEGDKQRQSADGAGCPPSSQPGAGSPPSSQPEAGRGPQKKPLGKQRDQKGSEGLEVQ
SKLGAKNTTLSSKRSPFLTKVPREKEKGSCPSVRLRRNASSAGRLQGLTSGSLAGSPGRK
ETKISEVYLPSGKKRPKSLELTISPEETGPLNPEILLLQEKMNTENPSSATTASEVATLK
TGPTVTLEKGFRNPGHATTRRLQDKAVCPLCRAQEGDPVGGSCVHISCSCSAASRDPEAS
LSRSSSCPRCQDLLPGKSHGSHEWQEGLQMASLNPKSLPQCKRHMKQAQLLFCEDHGELI
CLICRLSQEHRGHRVRPIEEAALEYKEQIQKQLDHLKELRKSGEEQRSQGDKKTVNSLKQ
AETQKQRIQYQLEQLCQFLEQQERLFVAWLEELGQTIGQVRETYGTQRTRDIALLDKLIG
ELEAKQCQPEWELMKDIGVTLHRAKMVTVPELWATPPEVKEKIHLLYQKSEFVEKRVKHF
LETLRSEVETFNVAELIGGQAHSVNVILEAETVHSNLIFHQSLGEKKCDHLPASPGKFYR
EVKVGDKPGWVLGVCNAGTSSKENMTLSPENGHLACTLLQIQMGEPCWHGGISVDYKMGI
SFYNVTAKSHITATGYFPPGPLQPILSPRTHDGEKNMDPLTICPVGVATAS
Download sequence
Identical sequences E1B7P5
ENSBTAP00000025458 ENSBTAP00000025458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]