SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025561 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025561
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 8.3e-24
Family S100 proteins 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025561   Gene: ENSBTAG00000019203   Transcript: ENSBTAT00000025561
Sequence length 101
Comment pep:known chromosome:UMD3.1:3:16887102:16888570:1 gene:ENSBTAG00000019203 transcript:ENSBTAT00000025561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDETAFQKLMS
NLDCNKDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Download sequence
Identical sequences L8HPQ3 P35466
NP_777020.1.59421 NP_777020.1.76553 XP_005910069.1.15283 XP_006040035.1.26621 XP_010836727.1.44457 XP_019810890.1.53367 9913.ENSBTAP00000025561 ENSBTAP00000025561 ENSBTAP00000025561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]