SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025568 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025568
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily DNA clamp 1.14e-17
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000025568
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00485
Family DNA polymerase processivity factor 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025568   Gene: ENSBTAG00000019209   Transcript: ENSBTAT00000025568
Sequence length 279
Comment pep:known_by_projection chromosome:UMD3.1:20:39265413:39274082:1 gene:ENSBTAG00000019209 transcript:ENSBTAT00000025568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQRIPDENDYCLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQA
NAFIQAGIFQEFRVQEESVTFRINLTVLLDCLSIFGSSPVPGTFTALRMCYQGYGYPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITM
SPDKPYFRLSTFGNAGSSHLDYPKDSDLMELFHCNETQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPDS
Download sequence
Identical sequences E1BB72
9913.ENSBTAP00000025568 ENSBTAP00000025568 ENSBTAP00000025568 NP_001179419.1.59421 NP_001179419.1.76553 XP_005221656.1.76553 XP_006071954.1.26621 XP_010815108.1.76553 XP_010852114.1.44457 XP_010852115.1.44457 XP_015314573.1.76553 XP_019838565.1.53367 XP_019838566.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]