SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025657 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025657
Domain Number 1 Region: 463-661
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-69
Family Hemopexin-like domain 0.00000000232
Further Details:      
 
Domain Number 2 Region: 90-219,392-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.74e-37
Family Matrix metalloproteases, catalytic domain 0.000000384
Further Details:      
 
Domain Number 3 Region: 278-335
Classification Level Classification E-value
Superfamily Kringle-like 2.31e-21
Family Fibronectin type II module 0.0000554
Further Details:      
 
Domain Number 4 Region: 338-394
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-20
Family Fibronectin type II module 0.0000848
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.000063
Further Details:      
 
Domain Number 6 Region: 44-108
Classification Level Classification E-value
Superfamily PGBD-like 3.61e-19
Family MMP N-terminal domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025657   Gene: ENSBTAG00000019267   Transcript: ENSBTAT00000025657
Sequence length 661
Comment pep:known chromosome:UMD3.1:18:23828638:23855657:1 gene:ENSBTAG00000019267 transcript:ENSBTAT00000025657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARVSRGALAALLRALCVLGCLLGRAAAAPSPIIKFPGDIAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFRF
NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVLPFTFLGNK
HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPGVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
Download sequence
Identical sequences F1MKH8
9913.ENSBTAP00000025657 ENSBTAP00000025657 ENSBTAP00000025657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]