SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025668 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025668
Domain Number 1 Region: 224-385,446-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 511-695
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.6e-22
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025668   Gene: ENSBTAG00000019277   Transcript: ENSBTAT00000025668
Sequence length 1074
Comment pep:known_by_projection chromosome:UMD3.1:5:30444365:30463019:-1 gene:ENSBTAG00000019277 transcript:ENSBTAT00000025668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDSWKESGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQREIESSASELPEIGWLQELARRLETPYYLVGRSPAAG
NSSGQSDNCSSSFGEANRTGPELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEK
IFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRML
EYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALR
PAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKAN
ADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGGPAEADTSSLS
GDNTLMSTLEEKETDGEQGPAASPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTVPRSRL
GGRGRPGRAGALQAEAGPSTHPRSLEGLRLPPVPWNVPPDLSPRVVDGIEDGCGSDQPQF
SFRVRQSGPECSSSPSPGPENGLLTVPLGPSEVRNTDTLDKLRQAVMELSEQVLQMREGL
QSLRQAVQLVLAPRGEGPCPAGASGLLQPLCVDTGASSCCLQPSAGSVLSGTWPHPRPGP
PPLMAPWPWGPPASQSSPWPRATAFWTSTSDSEPPGSGELCPEPSTPGLPPPEEGARTGP
PEPMTQAEAASTGEPPPASGGHALPWEPHSLEMVLIGCHGSGTVQWTQEEGTGV
Download sequence
Identical sequences E1B760
ENSBTAP00000025668 ENSBTAP00000025668 9913.ENSBTAP00000025668 NP_001179300.1.59421 NP_001179300.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]