SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025732 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025732
Domain Number 1 Region: 294-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-74
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 172-277
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-32
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 72-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000076
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000025732
Domain Number - Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000122
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025732   Gene: ENSBTAG00000019322   Transcript: ENSBTAT00000025732
Sequence length 558
Comment pep:known chromosome:UMD3.1:26:34304685:34340148:1 gene:ENSBTAG00000019322 transcript:ENSBTAT00000025732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARMSDLHVLLLMVLAGKTAFGLSLLSFLTEPDPDWTPDQYEYSQEYNNQEENASSTTA
YSDNPDWYYEEDDPCLSNPCTHGGDCLVSGATFTCRCPDPFSGNRCQNVQNKCKNNPCGR
GDCLITQSPPYHRCACKHPYRGSDCSRVVPVCRPNPCQNGGTCSRQRRRSKFTCACPDQF
KGKLCEIGPDDCYVDDGYSYRGRVSKTIHQHTCLYWNSHLLLQEKYNMFMEDAEAHGIGE
HNFCRNPDGDKKPWCFIKVNNVKVKWEYCDVPACSALDVANPEGRPTEPLTKFPEFGSCG
RTEIAEKKVKRIFGGFKSTAGKHPWQASLQTSLRLTVSTPQGHYCGGALIHPCWVLTAAH
CTEIKTKYLKVVLGDQDLTKTEFHEQSFGVQKIFKYSHYIEIDDIPYNDIALLKLKPVDG
HCALESKYVKTVCLPDGPFLSGTECYISGWGVTETGEGSRHLLDAKVKLISNTICNSRQL
YDHSIDDNMICAGNLQKPGQDSCQGDSGGPLTCEKDGTSYIYGIVSWGLECGKRPGVYTQ
VTKFLTWIKATMEKEASF
Download sequence
Identical sequences Q5E9Z2
9913.ENSBTAP00000025732 ENSBTAP00000025732 NP_001014868.1.59421 NP_001014868.1.76553 ENSBTAP00000025732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]