SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025803 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025803
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 8.8e-17
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 3 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000305
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025803   Gene: ENSBTAG00000019368   Transcript: ENSBTAT00000025803
Sequence length 282
Comment pep:known chromosome:UMD3.1:6:74071067:74150456:-1 gene:ENSBTAG00000019368 transcript:ENSBTAT00000025803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPPLPALLLGAAGLLLLLLPLSSSSSSDACGPCEPAACPPLPPRGCQLGETRDACGCC
PVCARGEGEPCGGGGAGRGHCAPGMECVKSRKRRKGKAGAAAGGPVVSGVCVCKSRYPVC
GSDGVTYSSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Download sequence
Identical sequences F1MPP2
ENSBTAP00000025803 ENSBTAP00000025803 XP_017904988.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]