SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025815 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025815
Domain Number 1 Region: 238-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000107
Family Growth factor receptor domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025815   Gene: ENSBTAG00000019375   Transcript: ENSBTAT00000025815
Sequence length 843
Comment pep:known_by_projection chromosome:UMD3.1:17:74523149:74534819:1 gene:ENSBTAG00000019375 transcript:ENSBTAT00000025815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGPRGAGPARRRGAGGPSLLLLLLWLLPGPTAPQELSPRGRNVCRAPGSQELTCCAG
WRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCV
CHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGACHPRSGACRCEPGWWGPQCASACYC
SATSRCDPQTGACLCHAGWWGRSCNNQCACNTSPCEQQSGRCQCRERTFGARCERYCQCF
RGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEP
GWNGTKCDQPCAAGFYGEGCGRRCPPCRDGHACNHVTGKCTRCNAGWIGDRCETKCSNGT
YGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNLTCPPGLHGVDCAQACSCHEDSCD
PVTGACRLETNQRKGVMGAGALLALLLGLLLSLLGCCCACRGKDPARGPRPRRELSLGRK
KAPQRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSWS
SRASFSSFDTTDEGPVYCVPHEEAAAESRDSEAPAAAPVTTPAEEAAPLPPSSDSERSAS
SGDGPGGALYARVARREARPARVRDEARGLSLSPSPERRKPPPPDPATKPKVSWIHGKQG
AGAAAAAATAPAPSPPPAGPEAAPSPSKRKRTPSDTSARPPGLAEEGPALGAPSPPRARA
RGRGPGLPEPTDAGGPPRSAPEAASMLAAELRDKTRSLGRAEGPAGMQGPREKPAPPQKA
KRSAPPSSPARAPPAPEALGPEKAAAGAPGSDTPRKKTPIQKPPRKKSRELAGEPGRVGA
PTL
Download sequence
Identical sequences E1B9M8
ENSBTAP00000025815 XP_005195225.2.59421 XP_005218360.1.76553 ENSBTAP00000025815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]