SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026111 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026111
Domain Number 1 Region: 372-576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.53e-40
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 594-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-39
Family Laminin G-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 36-242
Classification Level Classification E-value
Superfamily Fibronectin type III 6.52e-35
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 801-904
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000844
Family Laminin G-like module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026111   Gene: ENSBTAG00000019595   Transcript: ENSBTAT00000026111
Sequence length 904
Comment pep:known chromosome:UMD3.1:20:35999051:36178472:-1 gene:ENSBTAG00000019595 transcript:ENSBTAT00000026111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIRGVLLRLLLLASSLGPGAAPLRSALRKQGKVGPPLDIILDALNCSAFSIQWKMPRH
PPSPIMGYTVFYSEVGIDKSLQERSYGVPPGLDTPTSGRLDHQMIFEEVIGDLKPGTEYR
VSMAAYSQTGKGRLSSPQHVTTLPQDSCLPPTAPQQPHVIVVSDSEVALSWKPGESEGSS
PIQYYSVEFTRPDFDKSWTSIREQIQMDSMVIKGLDPDTNYQFAVRAVNPHGSSPRSQPS
STIRTARPEESGSGRYGPHYATDTEAGEDDDTFEDDLDLDISFEEVKPLPAIKEGNKKFF
VESKMAPRPNPMTVSRLVPPTPASLPTTAVAPQPTPVDRKGKHGVAVMPRLFDTSCDETV
CSADSFCVSDYTWGGSRCHCNLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQI
TLEFRAEAEDGLLLYCGENEHGRGDFMSLAVIRRSLQFRFNCGTGVAIIVSETKIKLGGW
HTVTLYRDGLNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGF
QGCVQALTVNGKRLDLRPWPLGKALSGADVGECSSGICDEASCINGGTCMASKADSYICL
CPLGFRGRHCEDAFTLTIPQFKESLRSYAATPWPLEPRHYLSFMEFEITFRPDSEDGVLL
YSYDTGSKDFLSINMAGGHVEFRFDCGSGTGVLRSEEPLTLGHWHELRVSRTAKNGILQV
DKQKAVEGMAEGGFTQIKCNSDIFIGGVPNYDDVKKNSGILKPFSGSIQKIILNDRTIHV
KHDFTWGVNVENAAHPCVGSPCAHGGSCRPRKEGYECDCPLGFEGLHCQKAITEAIEIPQ
FIGRSYLTYDNPDILKRVSGSRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDG
ALVF
Download sequence
Identical sequences F1N606
ENSBTAP00000026111 ENSBTAP00000026111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]