SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026133 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026133
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-38
Family Pentraxin (pentaxin) 0.0000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026133   Gene: ENSBTAG00000019616   Transcript: ENSBTAT00000026133
Sequence length 224
Comment pep:known chromosome:UMD3.1:3:10245766:10246803:-1 gene:ENSBTAG00000019616 transcript:ENSBTAT00000026133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLMSWVSVLIILPEAFAQTDLRGKVFVFPRESSTDHVTLITKLEKPLKNLTLCLRAYS
DLSRGYSLFSYNIHSKDNELLVFKNGIGEYSLYIGKTKVTVRATEKFPSPVHICTSWESS
TGIAEFWINGKPLVKRGLKQGYAVGAHPKIVLGQEQDSYGGGFDKNQSFMGEIGDLYMWD
SVLSPEEILLVYQGSSSISPTILDWQALKYEIKGYVIVKPMVWG
Download sequence
Identical sequences Q3T004
NP_001029638.1.59421 NP_001029638.1.76553 ENSBTAP00000026133 ENSBTAP00000026133 9913.ENSBTAP00000026133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]