SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026139 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026139
Domain Number 1 Region: 9-112
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000068
Family Ngr ectodomain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026139   Gene: ENSBTAG00000019622   Transcript: ENSBTAT00000026139
Sequence length 226
Comment pep:known_by_projection chromosome:UMD3.1:15:55237979:55238659:1 gene:ENSBTAG00000019622 transcript:ENSBTAT00000026139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPALLAALDAALAPLDELRLLGLAGNALSRLPPAALRRPRLEQLDVHLNALAGLDPDELR
ALERDGGLPAPRLLLADNPLRCGCAARPLLAWLRNSTERVPDARRLRCAAPRALHNRPFL
DLEEAQLRCADSDADSRGDEVELAGPELEASYVFFGLVLALIGLIFLMVLYLNRRGIQRW
MRNLREACRDQMEGYHYRYEQDADPRRAPARAAPAGSRATSPGSGL
Download sequence
Identical sequences F1N6L2
ENSBTAP00000026139 ENSBTAP00000026139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]