SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026142 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026142
Domain Number 1 Region: 185-295,408-558
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.97e-55
Family Phosphate binding protein-like 0.00000953
Further Details:      
 
Domain Number 2 Region: 3-171
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000297
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026142   Gene: ENSBTAG00000019623   Transcript: ENSBTAT00000026142
Sequence length 756
Comment pep:known_by_projection chromosome:UMD3.1:28:40732502:40966186:-1 gene:ENSBTAG00000019623 transcript:ENSBTAT00000026142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFWLSSQEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYL
QMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGH
ITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSR
LQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYG
HQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKIS
IFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVY
GAFVQQGGESSANSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSK
QVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAK
KGNYAFLWDVAVVEYAALTDDDCSVTVIANSVSSKGYGIALQHGSPYRDLFSQRILELQD
TGDLDVLKQKWWPHTGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALEL
WWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQA
LEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNG
GLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences F1N6E6
ENSBTAP00000026142 ENSBTAP00000026142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]