SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026179 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026179
Domain Number 1 Region: 333-410,445-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-49
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 127-187
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-18
Family B-box zinc-binding domain 0.00074
Further Details:      
 
Domain Number 3 Region: 85-118
Classification Level Classification E-value
Superfamily RING/U-box 0.0000848
Family IBR domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026179   Gene: ENSBTAG00000019646   Transcript: ENSBTAT00000026179
Sequence length 535
Comment pep:known_by_projection chromosome:UMD3.1:7:41751572:41760057:1 gene:ENSBTAG00000019646 transcript:ENSBTAT00000026179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEVEEEEEGVFWTSGMGGSNWDNMDYVWEEEEEEEDLDYYLGDMEEDLRGEEEEDEEE
VLEEDEEEELDPVTPLPPPPTPRRCFTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTA
GRGSRGNEQGICPKHQEALKLFCEVDEEAICVVCRESRNHKQHSVVPLEEVVQEYKAKLQ
GHVEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRL
REMHEAQLGRAGAAASRLSEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQ
PPEVWSPDPCQPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTAHPALMLSPDRRAVRL
AERRQEVADHSKRFSADCCVLGAQGFRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGS
GGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEK
PRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences E1BBY2
ENSBTAP00000026179 ENSBTAP00000026179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]