SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026254 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026254
Domain Number 1 Region: 299-495
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.05e-47
Family Reprolysin-like 0.00022
Further Details:      
 
Domain Number 2 Region: 512-587
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.71e-17
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000026254
Domain Number - Region: 743-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026254   Gene: ENSBTAG00000019694   Transcript: ENSBTAT00000026254
Sequence length 833
Comment pep:known chromosome:UMD3.1:2:95145119:95340402:1 gene:ENSBTAG00000019694 transcript:ENSBTAT00000026254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGNSSRRPPLAGCSLARASSGPRGGSAAPAPIRALARAPPCRLLLVLFLLPPLAASS
RPRAWGAAAPSAPYWNETAGKKLGVLADENNTLQQNSSSNSSSSHAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGNIRGVKDSRVALSTCNGLHGMFEDHTFVYMIEPLDLVHNE
KSTGRPHIIQKILAGKYSKQMKNLSMESSDRWPFLSELQWLKRRQKRAVNPSRGVFEEMK
YLELMIVNDHKTYKKCRSSLAHANNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTERDHI
DITTNLVQMLHEFSKYRQRIRQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEY
GLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILE
YRDFLLRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGIHVECYGLCCKKCSLSNGAH
CSDGPCCNNTSCLFQPRGYECRDAVNGCDITEYCTGDSGQCPPNLHKQDGYACNQNQGRC
YDGECKTRDNQCQYIWGTKASGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGF
LLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMM
CLERKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHP
PKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences A4FUX7
NP_001076927.1.59421 NP_001076927.1.76553 XP_005202790.1.76553 ENSBTAP00000026254 ENSBTAP00000026254 9913.ENSBTAP00000026254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]