SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026299 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026299
Domain Number 1 Region: 56-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000026299
Domain Number - Region: 423-684
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0101
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number - Region: 20-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0164
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026299   Gene: ENSBTAG00000019733   Transcript: ENSBTAT00000026299
Sequence length 689
Comment pep:known chromosome:UMD3.1:3:65921137:66062039:1 gene:ENSBTAG00000019733 transcript:ENSBTAT00000026299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLVGFSTLLNCCCTQNCTKTPCHPNAKCEIRNGREGCYCNTGYSGNGVTICEDDN
ECGNLTQSCGENANCTNTQGSYYCMCAPGFRSSNNQDKFITNDGTICVEIVNPDCHLDNA
CVAENINKTLTKIRHIEEPVALLREVYRNSLKDLSPMDIIAYTEVLAESSPLLGYMNSSN
SAKDTSSNSTLTEFVKTLNNFVQKDTFTVWDKLSTNQRITHLTKLIHTAEQATLRISQNF
QKTTQFDTNSSDIALKAFFFDSHHIKYIHPHMNMDGDNIKIFPKRKTAYDSNGSVAVAFL
YYKSIGPLFSSSDNLLEPQSYDKAEEEGRVISSVISLSISSNPPTLYELEKVTFTLSHIK
TTDKYKSQCAFWNYLPDTMNGSWSSEGCELTHSNDTHTSCRCNHLTHFAILMSSGSSIGI
KDYNILTRITQLGIIISLICLALCIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVGI
NTNTNKLFCSIVAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLSP
AVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHTA
GLKPEVSCYENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFIF
LFLCILSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences F1N570
ENSBTAP00000026299 9913.ENSBTAP00000026299 ENSBTAP00000026299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]