SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026334 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026334
Domain Number 1 Region: 323-690
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.04e-106
Family beta-glycanases 0.000000497
Further Details:      
 
Domain Number 2 Region: 23-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.83e-56
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 214-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000000623
Family beta-Galactosidase/glucuronidase domain 0.0059
Further Details:      
 
Domain Number 4 Region: 799-879
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000302
Family beta-Galactosidase/glucuronidase domain 0.0076
Further Details:      
 
Domain Number 5 Region: 696-795
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000216
Family beta-Galactosidase/glucuronidase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026334   Gene: ENSBTAG00000019761   Transcript: ENSBTAT00000026334
Sequence length 879
Comment pep:known chromosome:UMD3.1:6:23390299:23541416:1 gene:ENSBTAG00000019761 transcript:ENSBTAT00000026334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLLLAPCGAGFATKVVSISLRGNWKIHSGNGSLQLPAAVPGCVHSALFNKRIIKD
PYYRFNNLDYRWIALDNWTYIKKFKLHSDMSTWSKVNLVFEGIDTVAVVLLNSVPIGKTD
NMFRRYSFDITHTVKAVNIIEVRFQSPVVYANQRSERHTAYWVPPNCPPPVQDGECHVNF
IRKMQCSFGWDWGPSFPTQGIWKDVRIEAYNVCHLNYFMFTPIYDNYMKTWNLKIESSFD
VVSSKLVSGEAIVAIPELNIQQTNNIELQHGERTVELFVKIDKAIIVETWWPHGHGNQTG
YNMSVIFELDGGLRFEKSAKVYFRTVELVEEPIQNSPGLSFYFKINGLPIFLKGSNWIPA
DSFQDRVTSAMLRLLLQSVVDANMNALRVWGGGVYEQDEFYELCDELGIMIWQDFMFACA
LYPTDKDFMDSVREEVTHQVRRLKSHPSIITWSGNNENEAALMMGWYDTKPGYLQTYIKD
YVTLYVKNIRTIVLEGDQTRPFITSSPTNGAKTIAEGWLSPNPYDLNYGDVHFYDYVSDC
WNWRTFPKARFVSEYGYQSWPSFSTLEKVSSEEDWSYRSSFALHRQHLINGNNEMLHQIE
LHFKLPNSTDQLRRFKDTLYLTQVMQAQCVKTETEFYRRSRSEIVNGKGHTMGALYWQLN
DIWQAPSWSSLEYGGKWKMLHYFARHFFAPLLPVGFEDKDMLFIYGASDLHSDQQMMLTV
RVHTWSSLELVCSESTNPFVIKAGESVLLYTKPVPELLKGCPGCTRQSCVVSFYLSTDGE
LLSPINYHFLSSLKNAKGLHKANITATISQQGDTFVFDLKTSAVAPFVWLDVGSIPGRFS
DNGFLMTEKTRTVFFYPWKPTSKSELEQSFHVTSLADTY
Download sequence
Identical sequences A6QLB0
ENSBTAP00000026334 ENSBTAP00000026334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]