SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026358 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026358
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 1.57e-95
Family Triosephosphate isomerase (TIM) 0.000000000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026358   Gene: ENSBTAG00000019782   Transcript: ENSBTAT00000026358
Sequence length 249
Comment pep:known chromosome:UMD3.1:5:103942403:103945759:-1 gene:ENSBTAG00000019782 transcript:ENSBTAT00000026358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSARIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
Download sequence
Identical sequences Q5E956
9913.ENSBTAP00000026358 ENSBTAP00000026358 NP_001013607.1.59421 NP_001013607.1.76553 ENSBTAP00000026358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]