SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026435 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026435
Domain Number 1 Region: 1332-1397
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.27e-20
Family TB module/8-cys domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 660-728
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1506-1567
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1113-1240
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000011
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 862-988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 6 Region: 973-1113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 541-605
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000119
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 8 Region: 1233-1286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000635
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 611-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1611-1695
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000361
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1455-1499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000905
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 12 Region: 394-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000316
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 1404-1453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026435   Gene: ENSBTAG00000019839   Transcript: ENSBTAT00000026435
Sequence length 1709
Comment pep:known chromosome:UMD3.1:11:15493304:15947670:1 gene:ENSBTAG00000019839 transcript:ENSBTAT00000026435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAWLRWGLLLRAGLLASSAHGRVRRITYVVRPGPGLAAGALPLGGPPRPRTFNVALNA
RYSRSSAGAGAPSERTRRTSPPGGAALQGLRPPPPPPEPARPGGPGGPLHPKPGGHPAAA
PFAKQGRQAMRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGQCCHGWSKAPGSQRCTKP
SCVPPCQNGGMCLRPQLCVCKPGTKGKACETTAAQDTSSPVFGGQSTAAASSWVPPEQAA
KRTSSKKADALPRVSPVAQMTLTLKPKPSVGLSQQIHSQMTPLSSQNVMIHHGQTQEYVL
KPTYFTAQKVVSGEQSTEGSLPLRFGQDHVPAPFQLSNHTGRIKVVFTPSICKVTCTKGS
CQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKL
CQIPVHGASLPKVYQHSQQSGKALGTHVVHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKH
PPEASVQIHQVSRVDGPTGQKVKEAQPGQSQAPYQGLPVQKTQTVHSSYQQVIPHVYPVA
AKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFHKCQKCPKKPSYHGSCFLLW
CTVGWKSFSLPFCIYINECQLQGVCPNGECLNTMGSYRCTCKVGFGPDPTFSSCVPDTPV
ISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPG
GMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREQG
PGAVEPEVATVPPEKEIPSLDQEKTRLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPMPV
EVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYDGYKFNEQQR
KCVDIDECAQDQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGH
CVNTMGAFRCEYCDSGYHMTPGGQCEDVDECLTPSTCPDEQCVNSPGSYQCVPCTEGFRG
WNGQCLDVDECLEPKICTNGTCSNLEGSYMCSCHKGYSPTPDHKHCEDIDECQQGTMCMN
GQCKNTDGSFRCTCGQGYQLSAAKDQCEDIDECQHHHLCSNGQCRNTEGSFRCVCDHGYR
ASALGDHCEDINECLEDKSVCQGGDCINTKGSYECTCPDGFQLNDNKGCQDINECEQPGL
CGPHGECLNTDSSFHCICEQGFSISADGRTCEDIDECVNNTICDSHGFCDNTAGSFRCLC
YQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADESQEYSPMTGQCRSRL
SMDSEVDEPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVPG
TAEFTEMCPRGKGFVPSEESSYGVDGENYKDADECLLFGQEICKNGFCMNTQPGYECYCK
QGTYYDPVKLQCFEDIDECQDPNSCIDGQCINTEGSYNCFCTHPMVLDASEKRCIRPTES
HEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDD
YAQLCNIPVTGRRRPYGRDALVDFSEQYAPEADPYFVRDRFLNSFEELQAEECGILNGCE
NGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCVC
LPGFVPSDKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences F1N444
ENSBTAP00000049409 ENSBTAP00000026435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]