SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026471 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026471
Domain Number 1 Region: 276-427
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000739
Further Details:      
 
Domain Number 2 Region: 430-587
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.37e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000757
Further Details:      
 
Domain Number 3 Region: 647-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-38
Family MAM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 148-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-33
Family Spermadhesin, CUB domain 0.00000131
Further Details:      
 
Domain Number 5 Region: 26-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-32
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026471   Gene: ENSBTAG00000019866   Transcript: ENSBTAT00000026471
Sequence length 926
Comment pep:known_by_projection chromosome:UMD3.1:13:19911857:20056980:1 gene:ENSBTAG00000019866 transcript:ENSBTAT00000026471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGLQLLCAALALVLGAAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENESGRVLGKFCGKIAPSSFVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKKVVGPECSQNYTMPSGIIKSPGFPEKYPNSLECTYIIF
APKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRILS
SSGILSMLFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYS
TNWSAERSRLHYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETRKKYYVKTY
RIDISSNGEDWITIKEGNKPVIFHGNTNPTDVVIGVFPKPLITRFVRIKPVTWETGISMR
FEVYGCKITDYPCSGMLGMVSGLISDSQITASNQADRNWMPENIRLVTSRSGWALPPAPH
PYVNEWLQVDLAEEKIVRGVIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAK
SFEGNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGN
LVDECDDDQANCHSGTGDDFQLTGGTTVLTTEKPTVIDSTIQSEFPTYGFNCEFGWGSHK
TFCHWEHDNHVQLKWSVLTSKTGPIQDHTAGDGNFIYSQADENQKGKVARLVSPVVYSQN
AAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLY
QVIFEGEIGKGNLGGIAVDDISINNHIPQEDCAKPADLDKKNPESKIDETGSTPGYQGAG
EGDENISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALE
NYNFELVDGVKLKKDKLNPQSTYSEA
Download sequence
Identical sequences E1BMX5
ENSBTAP00000026471 9913.ENSBTAP00000026471 ENSBTAP00000026471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]