SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026522 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026522
Domain Number 1 Region: 1549-1653,1688-1831
Classification Level Classification E-value
Superfamily Cullin homology domain 5.89e-42
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1149-1304
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-35
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 370-444
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-30
Family CPH domain 0.0000164
Further Details:      
 
Domain Number 4 Region: 2235-2288
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000542
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 2076-2160
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000339
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 6 Region: 695-830,994-1122
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000154
Family RPA1889-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026522   Gene: ENSBTAG00000019908   Transcript: ENSBTAT00000026522
Sequence length 2522
Comment pep:known_by_projection chromosome:UMD3.1:23:16759132:16794939:1 gene:ENSBTAG00000019908 transcript:ENSBTAT00000026522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERRTGDLTVPLGPRLQAYPEELLRQRPGQDGHPEYLIRWSVLKCGEVGRAGVEEGKA
EHILMWLSAPEVYASCPTLLGERALSKGPQHETAGGPASFPRDPGSLDDVAMGEMEADVR
ALVRRAARQLAEGGTSSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNNSPEQGAGDRGSPTSREDLGREKSRG
QRELEFSMAVGNLISELVRSMGWARNLSQQGTLPPRPTRSIFQPSISGPSLLLPTIVAPP
RRQGRAFRQRAEFSSLSGYGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPV
QVFWQSTSRTYWVHWHMLEILGPEETTEDTASAAAEEGAGAAVPGTALPSWDWKPVDGLY
SLPYLQPEPQKNEKLGYLTQAEWWELLFFIRKLDICEQQSIYQSLRENLDESLGEKAVGE
ISVPVAMAESLLQVLRNRFEGSTLSDLLNSQIYTKYGLQPDALSGSSSSQNHSSTPDPEE
ESKSEATFSEEETESPNVKAQPLKAEAEPVKGKTELPMAQSDSQLFNQLLVTEGMALPAG
MKEAAGEMIRALRGPGPRSSLDQYVAAVVATVQISSLDTSLQLSALCALSQAVEEVTERD
HPLVHPDRFLREKLVKTLVELLTNQVGEKMVVVLALRLLYLLMTKHEWRPLFAREGGIYA
VLVCMQEYKTSVLVQQAGLAALKMLAIASSSEISTSVTSQDSIHPLFDAQMTREIFASID
SATRPDSESLLLALPAAVILMLNTEGCSSAVRNGLLLLNLLLCNHHTLGDQIITRELRDT
LFRHSGIAPGTEPMPTTRTILTMLLNRYSKPPGSPERSAAPETPSAQGQEGSPELLIRSL
VGGPSAELLLDLERVLCREGGPGGAVRPLLKRLQQESQPFLLFLWTLDAPGPNKTLLLTA
LRVMTQLLDHTEAMVLPWHEVLEPCLNCLNGPGSDSEIVQELLCFLYRLASTHKDYAVVL
CCLGAKDALTKVLEKHSAQLLLACELRDLVTECEKHAQLYSNLTSSILAGCIQMVLGQIE
DHRRTYRPINIPFFDVFLRHLCQGSSVEVKEDKCWEKLEVSSNPHRASKLTDRNPKTYWE
SNGSTGSHFITLHMHRGVLVRQLTLLVASEDSSYMPARVVVFGGDSASCINTELNTVNVM
PSASRVVLLENLSRVWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTC
LFYTIWAQAWSRDIAEDRKRLLQLCPRLNRVLRHEQNFADRFLPDEEAAQALGKTCWEAL
VSPLVQNITCPDAEGVSSLGWLLDQYLEQRESSRNPRGRAASFASRVRRLCHLLVHVEPP
PGPSPEPSARPPSKSSKARDRSPGPSPVLPSSSLRNITQCWLSVVQEQVSTFLAAAWRAP
DFVPRYCKLYERLQRAGLELFGPRAAFTLALRSGFSGALLQQSFLTTAHMSEQFARHIDQ
QIQSGLMGGTPGVEVLGRLQWHLEPIMVLSGLELATTFEHFYQHYMADRLLSLGSSWLEG
AVLEQIGLCFPNRLPQQMLRSLSTSEELQRQFHVYQLQQLDKLFLEQEDEEEQGLEEEEV
RAREEEEAEKELFIEDPSPTVSVLVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDRFSSF
YNQSQNHPALDVGPHRRLQWTWLGRAELQFADQTLHVSTVQMWLLLHFNQTEEVSVEALL
KNSGLSPELLLQALLPLTSDSGPLTLQEGQDFPPRGVLRLREPGLQPRGEALWLLPPQTY
LNVEKDEGRTLEQKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWHKGPNPPGSLGRA
IAGGVACTSTDVLSCILHLLGQGYVERRDDWPQILTYATPEPTGPCRGQAEIPFFGSQTS
ETSKISPEAVAALASLQLPAGRTMSPREVEGLMEQTVRQVQETLNLEPDVAQHLLAHSHW
GAEQLLQSYSDDPEPLLLAAGLRVPQAQAAPARPDHCPVCVSPLAPDRDLPALCCQHSCC
KSCWNEYLTTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVES
CANLTWCTNPQGCDRILCRQGLGCGTTCSKCGWASCFSCSFPEAHYPASCGHMSQWVDDG
GYYDGMSVEAQSKHLTKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNH
KDYYNCSAMVSKAARQEKRFQDYNERCTFHHQARDFAVNLRNRVSAIHEVPPPKSFTFLS
DACRGLEQARKVLAYACVYSFYNQDTEHMDVVEQQIEALELHTNALQILLEETLLHCRDL
ASSLRLLRAEHLNTGLELLRRIQERLLAILQHSTQDFRVGLQSPSSESREAKGPNVPGSQ
PQGSSELEEEEEDEEPEWQQDEFEEELDNDSFSYDEESENLDRETFFFGDEDDDEEDDEG
YD
Download sequence
Identical sequences E1BM39
ENSBTAP00000026522 ENSBTAP00000026522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]