SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026689 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026689
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-39
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 256-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-34
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026689   Gene: ENSBTAG00000020036   Transcript: ENSBTAT00000026689
Sequence length 376
Comment pep:known_by_projection chromosome:UMD3.1:3:92646538:92660013:1 gene:ENSBTAG00000020036 transcript:ENSBTAT00000026689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVELVFCLLLAVALLGPDLRAQAMKGVKCGGVLSAPSGNFSSPNFPSLYPYNTECSWLI
VVAEGSSVLLTFHAFDLEYHDTCGFDFLEIYNGASGDQGNLLGRFCGRVPPPPFTSSWHV
MSVVFHSDKHVASRGFSAAYQKDVCGGVLTGLSGVLASPEYPNNYPNNVECRWVIRAAGP
ATIKLVFVDFQVEGSEQCTYDYVAVLGGPGPAREHHYCGSARPPTLVSLGHELQVVFKSD
FNIGGRGFKAYYFSGECQEVYTAVRGNFSSPQYPSSYPNNIRCHWTIRLPPGYRVKVFFL
DLELEEPNSLTRTCDFDHLAAFDGASEEAPLLGTWCGHHLPPPVTSSHNQLLIVLHTDRS
TTHRGFSVAYIGGQLG
Download sequence
Identical sequences E1BPH1
ENSBTAP00000026689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]