SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026725 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026725
Domain Number 1 Region: 127-318
Classification Level Classification E-value
Superfamily vWA-like 1.19e-60
Family Integrin A (or I) domain 0.0000639
Further Details:      
 
Domain Number 2 Region: 1175-1378
Classification Level Classification E-value
Superfamily vWA-like 5.04e-59
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 2303-2507
Classification Level Classification E-value
Superfamily vWA-like 9.64e-57
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 4 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 1.48e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2524-2727
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-33
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 6 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 2.63e-24
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 7 Region: 1756-1926
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-22
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 8 Region: 1568-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-20
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 9 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-20
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 10 Region: 1940-2107
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 11 Region: 1385-1472
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-19
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 12 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 3.43e-19
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-18
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 14 Region: 2119-2207
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-17
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 15 Region: 1472-1563
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-17
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 16 Region: 2212-2295
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000222
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 17 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000267
Family Fibronectin type III 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026725   Gene: ENSBTAG00000020056   Transcript: ENSBTAT00000026725
Sequence length 3126
Comment pep:known_by_projection chromosome:UMD3.1:9:14869511:14983763:-1 gene:ENSBTAG00000020056 transcript:ENSBTAT00000026725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIRLPPALAALGAALLLSSIEAEVEPPSDLNFKIIDENTVHMSWAIPPDPIVGFKITVD
PTTDGPTKEFTLSASTTETLLTELIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPTKP
GEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYQQEELLAAIKKIPYKGGNTMTGEAIDYLIKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIATEVSSKYVKLSWSPSPSA
VTGYKVLLIPMTTGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGLTSSEPVSIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDINFSEVTSNSLKTSWSPAGENVF
SYHITYKEATGDDQVTLVEPASSTSVVLSNLKPETLYLVNVTAEYEDGFSIPLAGEETTA
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRITYRPVAGGESKEVTTPANQRRRTLE
NLTPDTKYEVSVIPEYVSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWTRAPGK
VKQYLITYTPVAGGDTQEVTVKGDTASTVLRGLNEGTQYALSVTALYASGAGDALFGEGT
TLEERGSPGDLITKDITDTSIGAYWTSAPGMVRGYRVSWQSLYDDIETGEKSLPADVIHT
VIENLQPETKYRVSIFATYSSGEGEPLSGEAMTELSEDSKTLKVDEETENTMRVTWKPAP
GKVVNYRVMYRPRGGGRQMVAKVSPTVTSTVLKRLQPQTTYDITVLPVYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHKDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDIHAYNVADFDSLSRIVDDLTNNLCNSVK
GPGDLEAPSNLVLSERTHRSMRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLERSTV
LKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYNIGSTTMHVQWQPVGGA
TGYTVTYEPINATVPTKPKEMRLEPTVNDVQLSDLFPNTEYAVTVQAVLHDLTSEPVTAR
EVTLPLPSPRDLKLRDVTHSTMNVAWEPAPGKVRKYIVRYKTPEEEAKEVEVDRSRASTP
LKDLFSQTLYTVSVSAVYEEGESPPVTAQETTHTVPAPTNLQITEVTPESFRGTWDHGAS
DVSLYRITWAPSGSADKMETILNGDENTLVFQNLNPNTLYEVSVTAIYPDESESDDLIGS
ERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQT
TTIGGRQNSVLLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
SLNVRWDHAEGSPRQYKLFYAPTAGGPEELVPIPGNTNYAILRNLQPDTQYTVTVVPVYS
EGDGGRTSDTGRTLVRGLARNVQVYNPTPNSLDVRWDSAPGPVQQYRIVYSPQDGTRPSE
SIVVPGNTYTVHLEQLIPDTPYSVNIVALYSDAEGNPSPAQGRTLPRSGPRNLRVFGETT
NSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIPV
YEDGDGTHLTGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVVIKGS
NEPMEVFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQV
GWDTFCVRWLAHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTDLSPETDYGVTVFVQ
TPNLEGPGVSVKERTTLKPTEAPTEPPTPPPPPTIPPAREVCKGAKADIVFLTDASWSIG
DDNFNKVVKFIFHTVGGFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIR
YRGGNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQSGFSV
FVVGVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDG
YTSPGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSSYRLQKNAFVNQPTVELHPNGLPP
SYTIILLFRLLPETPSDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTF
DTDEVKALFYGSFHKVHIVVTSKSVKIYIDCYEIVEKDIKEAGNITTDGYEILGKLLKGE
RKSATFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPA
GGPGAKGPRGERGVSGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAG
EPGLPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPG
KPGDHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYH
SSRNQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPQGERGLPGEKGERGIGSPG
PRGLPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYN
GQGYPVFFGPVADPFQVPEGGHEPFIVPVEPERTADEYEDYGADEPAGEHPPHARWRRAL
PHRPRQ
Download sequence
Identical sequences F1N401
ENSBTAP00000026725 ENSBTAP00000026725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]