SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026780 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026780
Domain Number 1 Region: 347-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-84
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 54-258
Classification Level Classification E-value
Superfamily Fibronectin type III 4.25e-41
Family Fibronectin type III 0.0000235
Further Details:      
 
Domain Number 3 Region: 644-718
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 4 Region: 2-40,92-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026780   Gene: ENSBTAG00000045902   Transcript: ENSBTAT00000026780
Sequence length 720
Comment pep:known chromosome:UMD3.1:2:130499267:130554058:-1 gene:ENSBTAG00000045902 transcript:ENSBTAT00000026780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPVDMPCTTIPSAPQA
VISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTE
PRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVD
SITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRA
RTVAGYGRYSGKMYFQTMTEGKRGQSAGGIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNR
RRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQV
IGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLE
GVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRD
LAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSA
SDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKD
RNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIK
MGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV
Download sequence
Identical sequences F1N3R6
ENSBTAP00000026780 ENSBTAP00000026780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]