SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026819 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026819
Domain Number 1 Region: 16-373
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-68
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 393-507,626-761
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.6e-58
Family Phosphate binding protein-like 0.00000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026819   Gene: ENSBTAG00000034854   Transcript: ENSBTAT00000026819
Sequence length 869
Comment pep:known chromosome:UMD3.1:1:5745203:5915273:1 gene:ENSBTAG00000034854 transcript:ENSBTAT00000026819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQKINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNRDLFYINLYPDYAAISR
AVLDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSAIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWWDGLTGRITFNKTDGLRKDFDLDIISLKEE
GTEKIGIWNSNSGLNMTDGNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGND
RFEGYCLDLLKELSNILGFIYDVKLVADGKYGAQNDKGEWNGMVKELIDHKADLAVAPLT
ITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVL
FVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGG
IWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSK
ISTYEKMWAFMSSRQQTALVKNSDEGIHRVLTTDYALLMESTSIEYVTQRNCNLTQIGGL
IDSKGYGVGTPIADPFMRKLTLAMINLQQEKSLHFNQEYWIRGHGRPKDSLQLAPWLGSF
NIASLFLIISQSLPNSVFICYMYFQFHGRKKQSLGVEKCLSFNAIMEELGISLKNQKKLK
KKSRTKGKSSFTSILTCHQRRTQRKETMA
Download sequence
Identical sequences F1N246
ENSBTAP00000026819 ENSBTAP00000026817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]