SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026827 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026827
Domain Number 1 Region: 2012-2179
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-33
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1740-1853
Classification Level Classification E-value
Superfamily CalX-like 3.66e-21
Family CalX-beta domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026827   Gene: ENSBTAG00000020141   Transcript: ENSBTAT00000026827
Sequence length 2180
Comment pep:known_by_projection chromosome:UMD3.1:8:29353418:29504029:1 gene:ENSBTAG00000020141 transcript:ENSBTAT00000026827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPSWGGLGALLLLLLLPGWASPTFVRVNQGVRVMKGSSAFLSQDDLKFTIPKEKDACK
VEVVMNEPITQRVGKLTPQVFDCHFLPNEVKYTHNGCPILDEDTVKLRLYRFTETDTFTE
TFILRVYLLEPDCNIIRMSDNALEVSEFYGLSRVIDKNLLRFDYERMASLECTVRLDPVG
THLPAHGQLVLVEPQLEEPRGDQPHSFFPESQLGTELKCPGGRCTLGLKKVGSLKVSCEE
FLLMGLRYQHLGSPSPNIDYFSIQLDLTDSRSKISYKSESAWLPVYIRPGIPNQIPRAAF
MAMFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLWDHTRPVSSFT
WKDLRDMQIAYQPPNSSHSERRLYEVELEVYDFFFEKSAPITVHISIRTTDTNAPRVSWN
TGLNLLEGQSRAITWEQFQIVDNDDIHAVQVVTVDGLQHGRLTVRGGKGFLFTVADLQAG
VVRYHHDDSDSTKDFVVFRIFDSQHSIQHKFPINILPKDDSPPFLITNVVIELEEGQTIL
IQGSMLRASDMDSSDDYIFFNITKPPQAGEIMKKPAPGLIGYPVPGFIQRDLFNGIIYYR
HFGGEIFEDSFEFVLWDSHEPPNLSVPQVVTIHVTPVNDQLPKEAPGVSRHLVVKETEVA
YITKKHLHFIDTESQDRELLYTITTPPFFSSSRRHLDAGKLFMVDSIPRLTKTPAAPGLK
YFTQHAVNHMKVAYMPPMQDVGPHPRHVQFAFSVSNQHGGTLYGICFNITILPVDNQAPK
VFTKPLRVAEGGQCVISTQHVLVSDEDTKLDNIYLSLQSPPQHGMVELNGFPLNKGTTFP
WGVLQALKLRYQHDGSEELQDDIVLQVTDGTNTAEYVLHVEVFPVNDEPPVLKADLIPMM
HCSEGEEVVITSEYIFATDVDSDDLKLIFMIVGEPQHGTVRRAGVTVHQFSQEDVVAGAV
TYKHTGGEIGLMPCFDTITLVVSDREAGPFVNGCCYNGPHPSVPLHESFPMYDLNITVYP
VDNQPPSVAIGTTFVVDEGFSAALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENTLPS
AGFEKSNMGISIASFQWKDMKALHINYVQSRHLGMEPTADKFVLYVTDGKRRSMEIPFYI
IINATNDEAPDFIVQNITVCEGQMRELDSSIISATDRDIPKNPLLFSITHKPRHGLLINR
AFSRNFFQYKQLANPGQKHELVYNFSMELLKNGMRLVYVHDDSESLADDFTIQVSDGKHK
ILKTIFVEVTPVNDEKPMLSKKAEITINMGETRIISSAVLSAIDEDSPREKIYYIFERIP
QNGQLQLKIGRDWVPLYPGMKCTQEEVDLNLLRYTHTGAMDSKNQDSFTFRLWDGDNRSP
AFDCHITIKNMGKGDIVILAKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPQF
GQVEYVRYPGVPITSFSQMDIAGQTVCYVDKSTTAVHRDTFRFIVSNGLQTKPGVFEITL
ETVDTALPVVTRNKGLRLVEGATGLLSPDLLQLTDPDTPAEKLTFLLAQLPRHGQLYLRG
MALIPHNFTQLDVDSGHVAYRHLGGDSWTDHFTFVATDGTNHGFLVDGRVWQEPVSFTIQ
VDQLDKAAPRVTHLHSPSQVGLLKNGCYGIYITSRVLKASDPDTDDNQIIFKILRGPQHG
HLENSTTGEFIHEKFSQKDLNSKTVLYIINPSLEVNSDTMEFQVMDPTGNSATPQSLELN
WSYIEWSRTEYEVCENMGMLPLEITRRGYSMDSAFVTVQVNQVSATVGKDFTMTPSKLVQ
FDPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKTAVKILDSKGGQCHPSN
AFNSNMPSAWEKGIWHLLSPGASSPTTSDSFHLERRPLPTSKQLAVTRGDALRDFGSEDL
SPVKLRTRGDGKTVPPSSVYKNRTDIIYNYHGVISLKLEDDGSPARRRKANVSFISEPQK
TTKVAEPPQADKEESTTGSHFPRQDPLPSFPKNCTPELKGLFHFEESLQKLYKCDGIAWR
SWSPHTKEVEDKSCPAGWHHHSGYCHSLITEQKGTWTTAAQACREHYQGSLVTVISRQHM
RWLWDISGRKPFWIGLNDQVRAGHWEWIGGEPVTFTNWRRGPPQRSRHGKDCVLVQRPGK
WHTKDCRKGKSHSYVCSRKL
Download sequence
Identical sequences E1BN52
ENSBTAP00000026827 ENSBTAP00000026827 NP_001179924.1.59421 NP_001179924.1.76553 XP_005209978.1.76553 XP_010806099.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]