SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026836 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026836
Domain Number 1 Region: 820-1108
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.0000000000392
Further Details:      
 
Domain Number 2 Region: 583-734
Classification Level Classification E-value
Superfamily Fibronectin type III 2.98e-20
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 445-636
Classification Level Classification E-value
Superfamily Fibronectin type III 4.05e-16
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 370-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000132
Family I set domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000026836
Domain Number - Region: 223-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 132-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0239
Family I set domains 0.077
Further Details:      
 
Domain Number - Region: 211-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026836   Gene: ENSBTAG00000020148   Transcript: ENSBTAT00000026836
Sequence length 1125
Comment pep:known chromosome:UMD3.1:8:17040335:17143857:-1 gene:ENSBTAG00000020148 transcript:ENSBTAT00000026836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAGLVLCGVSLLLSATVDGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDATREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVQVPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRICTACMNNGICHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSEPEGCKSFVFCLPDPYGCSCATGWKGLQCNE
ACQPGYYGPDCKLRCSCTNGEKCDRFQGCLCSPGRQGLQCEKEGVPRMTPKIEDLPDHIE
VNSGKFNPICKASGWPRPANEEMTLVKPDGTVLRPKDFNHTGHLSVATFTINRILPPDSG
VWVCSVNTVSGMVEKPFNISVKVLPKPLNAPKVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWRHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLSLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQMNSDQQNIKVPGNLTS
VLLNNLHPREQYIVRARVNTKAQGEWSEDLIAWTLSDIVPPQPENIKIFNITDSSAVISW
TILDGYSISAIIIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPQTVYQVDIFAENNIG
SSNPTSSHELTTLSESQAPADLGGRKMLLIAILGSAGMTCLTVLLAFLIMLQLKRANVQR
RMAQAFQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVL
KARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLY
LAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQ
FIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNS
DVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKP
YERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences Q06807
9913.ENSBTAP00000026836 NP_776389.1.59421 NP_776389.1.76553 XP_005904863.1.15283 ENSBTAP00000026836 ENSBTAP00000026836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]