SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026893 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026893
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-28
Family Kringle modules 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026893   Gene: ENSBTAG00000020190   Transcript: ENSBTAT00000026893
Sequence length 449
Comment pep:known_by_projection chromosome:UMD3.1:25:2372471:2377363:1 gene:ENSBTAG00000020190 transcript:ENSBTAT00000026893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRPPKALLLLLLLRLLPPRGASAGSLQSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LYWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEEEGTNGLIRTGWTGPEEGTNLAELGME
EGPAKPIRAKREKGLQPVMRVGQLEEAEGKLQRGARRGQHPATVRPLSPPPPPRPRLGSS
APPAGLTPLSSGLQDADADPAPLEGSTQTPAVPLDGANVSCSPGPGGPEASMGAQVFSTV
TAVSVLLLLVLSLLRLLRGRGCLLAPGKGSPTLGPSRDPTRSWAVWYRRPRGVALPCPPG
DPQVEGLTASYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences E1BN12
ENSBTAP00000026893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]