SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026905 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026905
Domain Number 1 Region: 56-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000128
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026905   Gene: ENSBTAG00000020202   Transcript: ENSBTAT00000026905
Sequence length 324
Comment pep:known chromosome:UMD3.1:10:8038070:8052118:1 gene:ENSBTAG00000020202 transcript:ENSBTAT00000026905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTFKLQCHFILICLLALRGESRYLELREAVDHDPFPHLAGGASPKRELEGEPLYSRAL
RCVDMLSLQGQFTFTADRPQLHCATFFIAEPEEFITIRYDLVSIDCQRGDILQVFDGWIL
KGEKFPSSQDHPLPTTERYIDFCESGLSRRTIRSSQNVAMIFFRVHEPGNGFTVTMKTEP
NLFPCNIISQTPNGRFTLVVPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKKSSAGCG
GIGDFVELLGGTGLDPSKMLLLADLCYPLRGPAQMKVGCDHTVLRMVSSGKHINRVTFEY
RQLEPYELENPNGNSIQEFCLSTL
Download sequence
Identical sequences A7MBA3 L8IVJ9
ENSBTAP00000026905 NP_001094672.1.59421 NP_001094672.1.76553 XP_005890146.1.15283 ENSBTAP00000026905 9913.ENSBTAP00000026905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]