SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026956 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026956
Domain Number 1 Region: 414-596
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-41
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 2 Region: 197-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.36e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 600-780
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.35e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 6-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-33
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 806-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026956   Gene: ENSBTAG00000024021   Transcript: ENSBTAT00000026956
Sequence length 842
Comment pep:known chromosome:UMD3.1:11:32715365:32880569:-1 gene:ENSBTAG00000024021 transcript:ENSBTAT00000026956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTIS
VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRL
ELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRT
TEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKV
NDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTE
VWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGM
CRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQR
AYGILMATTSRDSADTLRLELDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGK
SLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAY
IDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLD
GLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSN
LHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLN
GRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLC
ND
Download sequence
Identical sequences F1N119
ENSBTAP00000026956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]