SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027071 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027071
Domain Number 1 Region: 1069-1114
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000255
Family Nuclear receptor coactivator interlocking domain 0.00057
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000285
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00053
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000445
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027071   Gene: ENSBTAG00000020312   Transcript: ENSBTAT00000027071
Sequence length 1465
Comment pep:known_by_projection chromosome:UMD3.1:14:35949385:36126601:-1 gene:ENSBTAG00000020312 transcript:ENSBTAT00000027071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTPDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGAWSGEPPRRNSHTFNCRMLVKPLPESEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPALPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHVLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHPAMCSGNPGQDMTLS
SNINFPMNGPKEQMGMPMGRFGGSGGMNHVSSMQATTPQGSNYALKMNSPSQSSPGLNPG
QPSSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPQLSKMGSLDSKDCFGLYGEPPEGPAGPA
ESSCHPGEPKDPSEAGLPPAGSNERPDGQSRLLDNKGQTKLLQLLTTKSDQIEPSPLPSS
LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQEAS
STAPGSEATIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIALKTEKEEMSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAESSPVTPVGAQKTAMRIPQSTFNNPRPGQLGRLLPNQNFPLDITLQSPTGAG
PFPPIRNSSPYPVIPQPGMMGNQGMIGNQGNLGNSSTGMIGSNAARPTMPSGEWAPQSPA
VRVTCAATSNAMNRPIQGGMIRNPTASIPMRPNSQPGQRQMLQPQVMNMGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQAPFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYMALRNFDGLEEIDRALGIPELVSQSQGVDPEQFSSQDSSLMLEQKTPVFPQQYASQ
AQMAQGSYTPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQSQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHHQQQQVQ
QRTLMMRGQGLNMTPSVVAPSGVPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGAA
APQSPLISPRLAHTQSPMLQQSQANPAYQASSDMNGWAQGSMGANSMFSQQSPPHFAQQA
NTSMYNNNMNINVSMATNTGGMNNMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRG
GGLFPSQLPGMDMIKQEGDASRKYC
Download sequence
Identical sequences E1BPY4
XP_002692770.3.76553 XP_010810389.1.76553 XP_010823635.1.59421 XP_015321812.1.59421 XP_015321813.1.59421 XP_015321814.1.59421 XP_015321815.1.59421 XP_015321816.1.59421 XP_015321817.1.59421 XP_015321818.1.59421 XP_015321819.1.59421 XP_015329957.1.76553 XP_015329958.1.76553 XP_015329959.1.76553 9913.ENSBTAP00000027071 ENSBTAP00000027071 ENSBTAP00000027071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]