SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027132 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027132
Domain Number 1 Region: 113-237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 491-803
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000915
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number 3 Region: 63-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000358
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027132   Gene: ENSBTAG00000026148   Transcript: ENSBTAT00000027132
Sequence length 816
Comment pep:novel chromosome:UMD3.1:7:11620385:11663606:1 gene:ENSBTAG00000026148 transcript:ENSBTAT00000027132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAPGLLVLLLFPMGPTAQNSKACALPCPPNSSCVNGTACRCAPGFISFSGEIFTDPLES
CDDINECGPPSPVDCGSSADCQNTEGGYYCTCSPGYEPVSGAMIFRNESENTCRQVDECQ
HRPRVCKGLSICINTEDSYTCQCPPGLEFTPEDQRHCTDVNECISGRNPCHSSAHCLNSV
DSFECCCHTGRLRQSLTPSFLSPDVDECSSRQHQCHNSTVCINTVGSYTCHCRQGWEPKP
GFWDKQRNTICKEISFPTWTALSGIKSQALSHFLNRIQDLGRNFSSASVLNTVRDLVQEM
GDLLETPGDLKTLPFSEQHFVVTNLLFGLENVLRGVSKALPKGSFTFNSSAGIELSLEVQ
APSYRNITLIQKQTKMMLTWDTVHDSGDSGLAVVGLLSTPGMDRFLAEAPLVLDAEELTT
LHETHRGLLQETSHILLSDVISAFITNKDTENLRSPVTFVFQHSVTPGPREKVHCVYWEH
GQNGSGHWDTRGCWVTSTRDNSTTCQCSHLSIFAVLMAHYSVQEEDPALTVITYVGLSLS
LLCLLLVALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLTAIDRTESKVLCAFIAGALH
YLYLASFTWMLLVGLHLFLSARNLTVVNYSGINRFMKKAMFPVGYGVPAVIVAISAASRP
HLYGTPTSCWLHSEKGFKWGFLGPVCAIFSVNLAFFLMTLWILKRKLCSLNSEVSTLQDT
RMLTFKATAQLFILGCTWFLGILQVGPTAHVMAYLFTIINSLQGVFIFLVYCLLSQQVRE
QYRKWLKRIRKSKAESEKYTLSSRTMSDGCKHSEVR
Download sequence
Identical sequences G3X7G6
ENSBTAP00000027132 ENSBTAP00000027132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]