SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027152 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027152
Domain Number 1 Region: 136-310
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.45e-49
Family Acyl-CoA thioesterase 0.0001
Further Details:      
 
Domain Number 2 Region: 26-132
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 7.04e-37
Family Acyl-CoA thioesterase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027152   Gene: ENSBTAG00000020371   Transcript: ENSBTAT00000027152
Sequence length 317
Comment pep:known_by_projection chromosome:UMD3.1:13:75327439:75339408:1 gene:ENSBTAG00000020371 transcript:ENSBTAT00000027152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPQDPEDEQGGGDPPGDLRSVLVTSVLNLEPLDEDLFRGTHYWVPSTERLFGGQIVGQ
ALVAAAKSVSEDVHVHSLHCYFVRTGDPKVPVLYQVERTRTGASFSVRFVKAVQHGRPIF
ICQASFQKAQPSPVQHQFSMPAVPPPEEVVGREDFIGQFLRDPELQERYRVGLNRIAAQE
VPIEIKVVNPSTPSQLKKMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDFAFLGTAMLP
HHWKYKVGFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVSC
AQEGVIRVKPWDSTSKL
Download sequence
Identical sequences F6RWU6
NP_001068625.2.59421 NP_001068625.2.76553 ENSBTAP00000027152 ENSBTAP00000027152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]