SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027172 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027172
Domain Number 1 Region: 35-515
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-168
Family ALDH-like 0.00000000000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027172   Gene: ENSBTAG00000020385   Transcript: ENSBTAT00000027172
Sequence length 520
Comment pep:known chromosome:UMD3.1:8:62891041:62892603:1 gene:ENSBTAG00000020385 transcript:ENSBTAT00000027172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STQHAALPLPRLFALHHSATQYFSAAALPSPIPNPDIPDNQLFISNKWHDAVSKKTFPTV
SPATGEVIGHVAEGDWADVDLAAKAARAAFRLGSPWRWMDALKRGWLLNHLADLVERDCV
YLASLESLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVG
VCCQIIPWNFPLVMQSWKLALALAMGNTVVTKVAEQTPFSALYLASLIKEVGLPPGLVNI
VTGYGPTAGAAIAHHMDIGKVAFTGSTKVGHLIQKAAGNSSLKRVTLELGGKSLSIVLAD
ADMDHAVEQRQEALFFNMGQCCCPGSWTFIEESIYDEFLERTVEKAKQRRVGNPFDLDTQ
QGPQVDRERFERILGYIQLGQKEGAKLLCGGEHFRQQCFFIKPTVFGGVQDDMRIAREEI
FGPVQPLFKFKKIEEVIERADNTRYGLAAAVFTQDLDKAMYFTQALQTGTVWVNTYNVVT
CHTPLGGFKEPGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences G5E5P4
ENSBTAP00000027172 ENSBTAP00000027172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]