SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027182 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000027182
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0497
Family Molybdopterin synthase subunit MoaE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027182   Gene: ENSBTAG00000020394   Transcript: ENSBTAT00000027182
Sequence length 184
Comment pep:known chromosome:UMD3.1:3:19695881:19698696:-1 gene:ENSBTAG00000020394 transcript:ENSBTAT00000027182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLVLQAEKKLLSKMAGRSVAHLFADETSSEVLDELYRVSKEYTRSRPQAQRVI
KDLIKVAVKVAVLHRSGCFNPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLASLL
TECRDVLLELVERHLTPKSHGRIRHVFDHFSDAGLLTALYGPDYTQHLGKICGGLRKLLD
EGKL
Download sequence
Identical sequences Q3ZBK5
ENSBTAP00000027182 NP_001029561.1.59421 NP_001029561.1.76553 XP_012026560.1.54773 XP_019811370.1.53367 9913.ENSBTAP00000027182 ENSBTAP00000027182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]