SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027183 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027183
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000445
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027183   Gene: ENSBTAG00000020395   Transcript: ENSBTAT00000027183
Sequence length 225
Comment pep:known_by_projection chromosome:UMD3.1:3:19687360:19695881:1 gene:ENSBTAG00000020395 transcript:ENSBTAT00000027183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQAPLGGSGLLHGSRARSYGSLVQSACSPVRERRLEHQLAPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEAVQPSKDEVRPHS
AERKKRERGLGHANGEPLPTAGQEPARHDLSASDFLKKLDSQISLSKKAAAQKLKKGESG
IPGEDSSLHLSSPRMQQRAVLGPVPLTQTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences F1MNB9
ENSBTAP00000027183 9913.ENSBTAP00000027183 XP_010855837.1.44457 XP_019811350.1.53367 ENSBTAP00000027183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]