SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027347 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027347
Domain Number 1 Region: 324-448
Classification Level Classification E-value
Superfamily TIMP-like 8.79e-37
Family Netrin-like domain (NTR/C345C module) 0.00000177
Further Details:      
 
Domain Number 2 Region: 160-273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-36
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 38-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-36
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027347   Gene: ENSBTAG00000020528   Transcript: ENSBTAT00000027347
Sequence length 451
Comment pep:known chromosome:UMD3.1:25:36490771:36495789:-1 gene:ENSBTAG00000020528 transcript:ENSBTAT00000027347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLLTAWALLLPFTHGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPP
NKECIWTITVPKSQTVSLSFRVFDLEQHPSCRYDALEIFAGSGTSGQQLGRFCGTFRPAP
VVASGNQVTLRMRSDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESD
YPPGISCSWHIIAPPDQVISLTFGKFDLEPDSYCRYDSVSVFNGPVSDDAKRLGKFCGDT
VPGSITSEGNELLVQFVSDLSVTADGFSASYRTQPRGATEGVPGEVGLGPKPGAGPKVKP
EVPPEEKSKAAPKAEATPVGPDAPSVTCPKQCRRTGTLQSHFCNSDLVVTGMIKSMVRGP
GEGLTATVNVTGVYKTGGLDLPSPPTDTLLKFYVPCKQCPPMKKGISYLLMGQVDKNRGP
ILPPESFVVLHRPTQHQILTNLSRKCPSKPV
Download sequence
Identical sequences Q2HJB6
ENSBTAP00000027347 9913.ENSBTAP00000027347 NP_001039353.1.59421 NP_001039353.1.76553 XP_019843166.1.53367 ENSBTAP00000027347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]