SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027374 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027374
Domain Number 1 Region: 45-255
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.29e-56
Family Alanine racemase-like, N-terminal domain 0.000000153
Further Details:      
 
Domain Number 2 Region: 313-417
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.49e-17
Family Eukaryotic ODC-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027374   Gene: ENSBTAG00000020548   Transcript: ENSBTAT00000027374
Sequence length 502
Comment pep:known_by_projection chromosome:UMD3.1:2:121400544:121444433:-1 gene:ENSBTAG00000020548 transcript:ENSBTAT00000027374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLRETDFVMVEEGFSTRDLLEELTLGASQATTEEVAAFFVADLGAVVRKHFCFLKCL
PRVRSFYAVKCNSSPGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIIYANPCKQIAH
IKYAAKHGVRLLSFDNEMELAKVVKSHPSAKMVLCVATEDSHSLSRLSLKFGASLKSCRH
LLENAKRDHVEVVGVSFHIGSGCPDPQAYAQSIADARVVFEMGAELGHRMHILDLGGGFP
GVEDAKVRFEEVSGVTGVALGWARVGGRATVILGSPLRHYFTSVYTISDKLASKKKVTVC
PPGWMWETTGMPATLVHHFGDGQGGLFSDLMLSSLSDCPSLLQKPSTEQPLYSSSLWGPV
ASGCDCVAEGLWLPQLHVGDWLVFENMGAYTVGVGSLLRGAQTCRITYAMSRVAWEALQG
QLLPAEQDEDAEGMCKPLSCGWEITDTLCMGPVFTPASIMCIPETLASGTSQVEQTTPRT
SLPAPRSRVGSALVLGEVLAGI
Download sequence
Identical sequences F1N7A5
ENSBTAP00000027374 ENSBTAP00000027374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]