SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027467 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027467
Domain Number 1 Region: 28-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.36e-100
Family Glycosyl hydrolases family 35 catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 473-612
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-31
Family Beta-galactosidase LacA, domains 4 and 5 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027467   Gene: ENSBTAG00000020611   Transcript: ENSBTAT00000027467
Sequence length 647
Comment pep:known_by_projection chromosome:UMD3.1:2:107908452:107915086:-1 gene:ENSBTAG00000020611 transcript:ENSBTAT00000027467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKPLCLPFLLLPLLTLLLPQADARSFVVDRDHNRFLLDGAPFRYVSGSLHYFRVPRV
LWADRLLKMRMSGLNVVQFYVPWNYHEPEPGVYNFNGSRDLFAFLKEATLANLLVILRPG
PYICAEWEMGGLPAWLLRKPKIHLRTSDPDFLAAVDSWFKVLLPRIYPWLYHNGGNIISI
QVENEYGSYRACDVSYMRHLAGLFRALLGDRILLFTTDGPEGLKCGSLQGLYTTVDFGPA
DNMTKIFGLLRKYEPRGPLVNSEYYTGWLDYWGQNHSTRSIPAVTKGLEKMLKLGASVNM
YMFHGGTNFGYWNGADEKGRFLPITTSYDYDAPISEAGDPTPKLFAIRNVISKFQEVPLG
PLPPPSPKMTLGPLNLHLDGNLLDFLDFLCPQGPIHSVLPMTFEAVNQVHGYMLYRTYLP
HTVSEPTQLWVPNNGVHDRAYVMVDGVFQGVLERNMKHNLFLMGKIGATLDVLLENMGRL
SFGSNSSDFKGLLQPPILGQTILTQWLMFPLKVDNLVKGWFPIQPLKHSHPQTPSGPTFY
STTFPILNSGGDTFLFLPGWTKGQVWINGFNLGRYWTKRGPQQTLYVPRPLLFPRGAHNR
ITLLELENVPPQPQIQFLDRPILNSTKHRTYVYSLSSASEPMELSGH
Download sequence
Identical sequences E1BCP9
NP_001192931.1.59421 NP_001192931.1.76553 XP_019832712.1.53367 XP_019832717.1.53367 9913.ENSBTAP00000027467 ENSBTAP00000027467 ENSBTAP00000027467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]