SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027527 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027527
Domain Number 1 Region: 3812-4012
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-39
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 3329-3440
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 3223-3327
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 3119-3222
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-29
Family Cadherin 0.00042
Further Details:      
 
Domain Number 6 Region: 2276-2382
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 2803-2911
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 3017-3125
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-27
Family Cadherin 0.00068
Further Details:      
 
Domain Number 10 Region: 1556-1657
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-26
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 1031-1132
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-26
Family Cadherin 0.00072
Further Details:      
 
Domain Number 12 Region: 816-919
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-25
Family Cadherin 0.00078
Further Details:      
 
Domain Number 13 Region: 1759-1879
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 14 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-25
Family Cadherin 0.0025
Further Details:      
 
Domain Number 15 Region: 2912-3023
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0025
Further Details:      
 
Domain Number 16 Region: 2069-2176
Classification Level Classification E-value
Superfamily Cadherin-like 3e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 3433-3537
Classification Level Classification E-value
Superfamily Cadherin-like 4e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 2176-2283
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1450-1554
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 21 Region: 457-551
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.00088
Further Details:      
 
Domain Number 22 Region: 1660-1781
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 23 Region: 2383-2483
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 24 Region: 2584-2694
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-20
Family Cadherin 0.00094
Further Details:      
 
Domain Number 25 Region: 2486-2596
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-18
Family Cadherin 0.0027
Further Details:      
 
Domain Number 26 Region: 1358-1456
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-17
Family Cadherin 0.006
Further Details:      
 
Domain Number 27 Region: 1233-1347
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-17
Family Cadherin 0.0041
Further Details:      
 
Domain Number 28 Region: 1872-1969
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-16
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 562-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000903
Family Cadherin 0.0038
Further Details:      
 
Domain Number 30 Region: 2702-2801
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000642
Family Cadherin 0.0035
Further Details:      
 
Domain Number 31 Region: 1978-2081
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000728
Family Cadherin 0.0021
Further Details:      
 
Domain Number 32 Region: 366-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.0026
Further Details:      
 
Domain Number 33 Region: 4127-4164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000256
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 34 Region: 3542-3631
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000103
Family Cadherin 0.0081
Further Details:      
 
Domain Number 35 Region: 4092-4131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.016
Further Details:      
 
Domain Number 36 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000328
Family Cadherin 0.0079
Further Details:      
 
Domain Number 37 Region: 4053-4089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.01
Further Details:      
 
Domain Number 38 Region: 4014-4054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000228
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027527   Gene: ENSBTAG00000020657   Transcript: ENSBTAT00000027527
Sequence length 4587
Comment pep:known chromosome:UMD3.1:27:15477549:15604015:-1 gene:ENSBTAG00000020657 transcript:ENSBTAT00000027527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLASLLLLLRLLQHFRDGDGSGTLEEMPLQFTHFQYNVTVHENSAAKTYVGHPVKMG
IYMTNPLWELRYKIISGDNENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKNTNAEARTQVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGTIVLTGRLDYTETSVYEMEILAVDRGMKLYGSSGISSM
AKLTVHVEQANACAPVITAVTSSPSELDRDPTYAIVTVDDCDQGANGEVASLSIVAGDLL
QQFRTVRSSPGSREYKLKATGAIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVISPRF
KAGPVRFEKEVYRAEISEFAPPHTPVVMVKATPSYPHLKYVFKSTPGKAKFSLNHNTGLI
SILEPLKRQQASHFELEVTTSDRKASTRVLVKVLSANSHPPEFTQTAYKASFDENVPIGT
TVMSVSAVDPDEGENGYVTYSIANLNHVPFVINHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGSPYRREIEILATLTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVRYQIEAGNELDLFSLNPNSGVLSLKQSLMDGLGAKVSFHSLRITATDGENFATPLYIN
MTVAALRKPVSLQCEETGVAKMLAEKLLQANKLHSQGEVEDVFFDSHSVNAHAPQFRSTL
PAGIQVKENQPVGSSLLVMNATDLDTGFNGKLVYAVSGGNEDSCFIMDMETGMLKILSPL
DRETTDRYTLNITVSDLGLPQRAAWHLLEIRVLDANDNPPEFLQESYFVEVSEDKEINSE
IIQVEATDKDLGPNGHVRYSILTDTDKFSIDSVTGVVKILNPLDREEQQVHYLKVEARDQ
AREEPQLLSTVILKVSLDDVNDNPPKFIPPNYRVKVREDLPEGTIIMWLEAHDPDLGQSS
QVRYSLLDHGEGNFDVDKLSGAVRIIQQLDFEKKQVYNLTVRAKDKGKPISLSSTCYVEV
EVIDVNENLHPPVFPSFVEKGAVKENAPLGSSVMKVSARDEDMGRDGEIHYSIRDGSGVG
VFRIDEETGVIETSDRLDRESTSHYWLTVYASDQGVVPLSSFVEVYIEVEDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSDDKLTYKITSGNPQGFFSINSKTGLITTTA
RKLDREQQDEHILEVTVTDNGSPPKLTITRVIVKILDENDNKPQFLQKFYKIRLPEREKP
ERERNAKREPLYRVIATDKDEGPNAEISYSIEEGNEHGKFFIEPKTGVVLSKKFSGAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVI
SVEPPGIPLWFDIIGGNYDSHFDVDRGTGTIIIAKPLDAEQKSNYNLTVEATDGTTTILT
QVFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILQISAVDKDEKNKLIYTLQSSIDPL
SLKKFRLDPATGSLYTSEKLDHEAIHQHILTVMVRDQDVPVKRNFARIVVNVSDTNDHAP
WFTSSSYEGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFTIDPILGSIK
TARELDRSNQVAYDLMVKATDRGDPPMSEITSVRVFVTIADNASPKFTSKEYSVEISETV
GIGSFVGMVTAHSQSSVVYEIKDGNVADAFDINPHSGSIITQKALDFETLPIYTLTIQGT
NMAGLSTNTTVLVHLLDENDNLPLFVQAEYTGLISESASINSVVLTDRNVPLVIRATDAD
RESNALLVYHIVEPSVHKYFTIDSSTGAIHTVLSLDYEETSTFHFTVQVHDMGTPRLFAE
YAANVTIHVIDINDCPPVFSTSLYEASLLLPTYRGVKVVAVNATDADSSAFSQLMYSITE
GNIGEKFLMDRKTGTITVQNTTQLRSRYELTVRASDGRFASFAAIKINVKESKESQLKFT
QDFYSAIVKENSTEARTLAVITALGNPINEPLFYHILNPDPRFRISRTSGVLSTTGIPFD
REQQEAFDVVVEVTRERKPPAVAHVIVKVVIEDQNDNAPVFVNLPYYALVKVDAAVGQVI
RHVTAVDRDSGRNGEVHYFLKERHEHFQIGSSGEISLKKPFEPDTLNKEYLITVVARDGG
DPAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENAQLHSPVVHVQANSPEGLKVHYSITE
GDPFSQFTVNFNTGVISVVAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIIVEDINDNP
PVFAQQSYATTLSEASVIGTSVVQVRATDADSEPNRGISYHMVGNHSKSHDHFHVDSGTG
LISLVRTLDYEQFRQHQISVRAVDGGMPPLSSDVVVTVDVTDLNDHPPLFDQQLYEARIS
EHAAHGHFVTCVRAYDADSSDADKLEYSILSGNDHKNFVIDGKTGIITLSNLRRHALKPS
YSLQVSASDGVFRSSAQVHVTVIGGNLHSPLFLQNEYEVELAENAPLHTLVTEVKASDGD
SGIYGHVTYHIVNDFAKDRFYTNERGQIFTLEKLDRETPAEKVIPIRFMAKDAGGKVAFC
TINVILTDDNDNAPQFRATKFEVNIGSSAPKGTSVIKVLASDADEGSNADITYAIEADSE
SVKENLEINRASGVITTKESLIGLENEVFTFFVRAVDNGSPQRESVVPVYVKVLPPEMRL
PRFSEPFYTYTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDEFFVIDRQSGRL
KLEKSLDHETTKWFQFSVLARCTHGDYELVASVDVSIQVKDTNDNSPVLESSPYEAFIVE
NLPAGSRVIQIRASDLDSGSNGQVMYNLDQSQSVDVIESFAVNMETGWITTLRELDHEKR
DSYQIKVVASDHGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAIV
STTDADSEEINRQVTYYITGGDPLGQFAIENIQNEWKVYVKKPLDREERDSYLLTITATD
GTFSSKAIVEVKVLDANDNTPVCEKTLYSDTIPEDAFPGKLIMQVSATDADIRSNAEITY
TLFGPGAEKFKLNPDTGELKTSAPLDREEQAAYHLLVKATDGGGRFCQASVVLTLEDVND
NAPEFSADPYTITVFENTEPGTLLTRVQATDADAGLNRKISYSLLNSADGQFSINELSGI
IQLEKPLDRELQAVYTLTLKAVDHGLPRRLTATGTIVISVLDINDNPPVFEYREYGATVS
EDILIGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAIFIIENLDYESSHE
YYLTVEATDGGTPSLSDVATVSINVTDINDNAPVFSQDTYTAVVSEDAVLEQSVITVMAD
DADGPSNSHIHYAIIDGNQGSPFTIDPARGEVKVTKLLDRETISGYTLTVQASDNGSPPR
VTTTTVNIDVSDVNDNAPVFSRGNYSLIIQENKPVGFSVLQLVVTDRDSSHNGPPFFFSI
VSGNEEGAFEVNQQGALLTAAAINRKVKDHYLLHVKVADNGKPQLSSLTYIDIRVIEESV
YPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDSLFSVSSTGGKLI
AHKKLDIGQYLLNVSVTDGKFTTAADITVQVRQVTQEMLNQTVAVRFANLTPEEFVGDYW
RNFQRALRNILGVRRNDIQIVSLQPAEPHPHLDVLLFVERSGVTHVSTRQLLQKINSSVS
DVEEIIGVRILEVFRKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHRRMAVC
LCREGKCPLVHHGCEDNPCPEGSECVTDPREETYTCVCPGGKSGQCPGSASVTFTGNSFV
KYRLMENENKLEMKLTMRLRTYSAHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPGIVS
VQSIQVNDGLWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDSHVYFGGHVRQQG
SRHGRSPQVGNGFRGCMDSIYLNGQELPLNNRPRSYAHIEESVDVSPGCLLTATEDCSSS
PCQNGGVCHPSPTGGYYCKCNTLYVGTYCEVSVNPCSSNPCLYGGTCIVDNGDFVCQCRG
LYSGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDVDECAGNPCRNGA
LCENTHGSYHCNCSHEYKGKHCEDVAPNQYVSTPWNIGLAEGIGIVVFITGIFLLVLVFV
FCRKMISRKKKPQPEPEDKHLGPSAAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSI
PSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSDS
DSIQKPSWDFDYDTKVVDLDPCLSKKPLEEKPSQPYSARESLSEVHSLSSFQSESCDDNG
YHWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPE
DFPGADELPPLPPEFSDQFESIHPPRDAPAAGSPGSASRGRQRFHPNQYLPSFYAVDLSE
PQKAGAGDGSARREPYAPYPAGYPRTFEAPAVESLPLSVYASTASCSDVSACCEAESEVM
MSDYESGDDPFEEVTVPPLDSQQHTEV
Download sequence
Identical sequences E1BKL9
ENSBTAP00000027527 ENSBTAP00000027527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]