SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027551 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027551
Domain Number 1 Region: 289-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-54
Family SPRY domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000916
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027551   Gene: ENSBTAG00000020671   Transcript: ENSBTAT00000027551
Sequence length 475
Comment pep:known_by_projection chromosome:UMD3.1:2:121347861:121383138:1 gene:ENSBTAG00000020671 transcript:ENSBTAT00000027551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSAFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALH
EQHQVTGIDDAFEELQRELKEQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGE
AFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETD
RHTFLAGMASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD
PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEK
TQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
Download sequence
Identical sequences E1BK51
ENSBTAP00000027551 ENSBTAP00000027551 9913.ENSBTAP00000027551 NP_001192764.1.59421 NP_001192764.1.76553 XP_005202990.1.76553 XP_006054733.1.26621 XP_017913583.1.57651 XP_019834306.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]