SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027556 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027556
Domain Number 1 Region: 519-711
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.59e-59
Family Hemopexin-like domain 0.0000000352
Further Details:      
 
Domain Number 2 Region: 90-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-31
Family Matrix metalloproteases, catalytic domain 0.000000845
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily Kringle-like 1.94e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 2.83e-21
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 5 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 3.61e-20
Family MMP N-terminal domain 0.00016
Further Details:      
 
Domain Number 6 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027556   Gene: ENSBTAG00000020676   Transcript: ENSBTAT00000027556
Sequence length 712
Comment pep:known chromosome:UMD3.1:13:75466513:75473824:1 gene:ENSBTAG00000020676 transcript:ENSBTAT00000027556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLQPLVLALLVLACCSAVPRRRQPTVVVFPGEPRTNLTNRQLAEEYLYRYGYTPGAEL
SEDGQSLQRALLRFQRRLSLPETGELDSTTLNAMRAPRCGVPDVGRFQTFEGELKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGKGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFQGRTYS
ACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSA
CTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMY
PMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPTTTTTTITEPQPTAPPTVCVTGPPTA
RPSEGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIRNRLHFFK
AGKYWRLSEGGGRRVQGPFLVKSKWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASL
LGPRRLDKLGLGPEVAQVTGALPRPEGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFP
GVPISTHDIFQYQEKAYFCQDHFYWRVSSQNEVNQVDYVGYVTFDLLKCPED
Download sequence
Identical sequences F1MF56
9913.ENSBTAP00000027556 ENSBTAP00000027556 ENSBTAP00000027556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]